HPA019461

SAMD9L antibody from Atlas Antibodies
C7orf6, FLJ39885, KIAA2005
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019461
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019461, RRID:AB_1856555
Product name
Anti-SAMD9L
Provider product page
Atlas Antibodies - HPA019461
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLK
MRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCL
LQSKESQLLQEENCRKKLEALRADRFAGLLEYLNP
NYKDAT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -