HPA019465

SAMD9L antibody from Atlas Antibodies
C7orf6, FLJ39885, KIAA2005

Antibody data

Product number
HPA019465
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019465, RRID:AB_2183384
Product name
Anti-SAMD9L
Provider product page
Atlas Antibodies - HPA019465
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSKQVSLPEMIKDWTKEHVKKWVNEDLKINEQYGQ
ILLSEEVTGLVLQELTEKDLVEMGLPWGPALLIKR
SYNKLNSKSPESDNHDPGQLDNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.