HPA019465

antibody from Atlas Antibodies

Targeting: SAMD9L C7orf6, FLJ39885, KIAA2005

Antibody data

Submit

Validation data

Product number: HPA019465 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019465, RRID:AB_2183384
Product name: Anti-SAMD9L
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MSKQVSLPEMIKDWTKEHVKKWVNEDLKINEQYGQ ILLSEEVTGLVLQELTEKDLVEMGLPWGPALLIKR SYNKLNSKSPESDNHDPGQLDNS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SAMD9L protein structure - HPA019465 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human appendix and skin tissues using Anti-SAMD9L antibody. Corresponding SAMD9L RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human appendix, kidney, lymph node and testis using Anti-SAMD9L antibody HPA019465 (A) shows similar protein distribution across tissues to independent antibody HPA019461 (B).
Antibody #2 product nr: HPA019488, HPA019461
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human appendix shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SAMD9L antibody HPA019465.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SAMD9L antibody HPA019465.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SAMD9L antibody HPA019465.
Sample type: HUMAN