HPA019488

SAMD9L antibody from Sigma-Aldrich
C7orf6, FLJ39885, KIAA2005
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019488
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019488, RRID:AB_1856557
Product name
Anti-SAMD9L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019488
Antibody type
Polyclonal
Antigen
Sterile alpha motif domain-containing protein 9-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLS
LFVREGASSRDILANSKQRDVDFKAFLQNLKSLVA
SRKEAEEEYGMKAMKKESEGLKLVKLL
Storage
-20C
Provider Type Product Number
- No reagents -