HPA011741

NPRL3 antibody from Sigma-Aldrich
C16orf35, CGTHBA, HS-40, MARE, NPR3, RMD11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011741
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011741, RRID:AB_1845577
Product name
Anti-C16orf35 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011741
Antibody type
Polyclonal
Antigen
UPF0171 protein C16orf35 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDSRFSDVILATILATKSEMCGQKFELKIDNVRFV
GHPTLLQHALGQISKTDPSPKREAPTMILFNVVFA
LRANADPSVINCLHNLSRRIATVLQHEERRCQYLT
REAKLILALQDEVSAMADGNEGPQSPFHHILPKCK
Storage
-20C
Provider Type Product Number
- No reagents -