H00055610-M01
antibody from Abnova Corporation
Targeting: VPS50
CCDC132, DKFZp313I2429, FLJ20097, KIAA1861, VPS54L
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055610-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055610-M01, RRID:AB_534868
- Product name
- FLJ20097 monoclonal antibody (M01), clone 2D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FLJ20097.
- Antigen sequence
GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRP
IPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQ
LTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR- Isotype
- IgG
- Antibody clone number
- 2D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references EARP is a multisubunit tethering complex involved in endocytic recycling.
Schindler C, Chen Y, Pu J, Guo X, Bonifacino JS
Nature cell biology 2015 May;17(5):639-50
Nature cell biology 2015 May;17(5):639-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FLJ20097 monoclonal antibody (M01), clone 2D11. Western Blot analysis of FLJ20097 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FLJ20097 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FLJ20097 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol