HPA026679

VPS50 antibody from Sigma-Aldrich
CCDC132, DKFZp313I2429, FLJ20097, KIAA1861, VPS54L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026679
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026679, RRID:AB_1846135
Product name
Anti-CCDC132 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026679
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 132 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFE
IQANHKDEETEDVLASNGYESDEQEKSAYQEYDSD
SDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKS
DYSLNKVNAP
Storage
-20C
Provider Type Product Number
- No reagents -