HPA027382

CDC42BPG antibody from Atlas Antibodies
DMPK2, HSMDPKIN, kappa-200, MRCKgamma

Antibody data

Product number
HPA027382
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027382, RRID:AB_1846378
Product name
Anti-CDC42BPG
Provider product page
Atlas Antibodies - HPA027382
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEP
DLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPG
SH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.