H00055561-A01

CDC42BPG antibody from Abnova Corporation
DMPK2, HSMDPKIN, kappa-200, MRCKgamma
No application information provided.

Antibody data

Product number
H00055561-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055561-A01, RRID:AB_563219
Product name
CDC42BPG polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00055561-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CDC42BPG.
Antigen sequence
RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPG
ARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPAS
MGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSP
A
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -