HPA027382

CDC42BPG antibody from Sigma-Aldrich
DMPK2, HSMDPKIN, kappa-200, MRCKgamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027382
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027382, RRID:AB_1846378
Product name
Anti-CDC42BPG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027382
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase MRCK gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEP
DLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPG
SH
Storage
-20C
Provider Type Product Number
- No reagents -