Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003669-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003669-M01, RRID:AB_425513
- Product name
- ISG20 monoclonal antibody (M01), clone 1B2-3C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ISG20.
- Antigen sequence
MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHG
AVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGY
TIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLP
RLAVSD- Isotype
- IgG
- Antibody clone number
- 1B2-3C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Antiviral activities of ISG20 in positive-strand RNA virus infections.
Intracellular activation of interferon regulatory factor-1 by nanobodies to the multifunctional (Mf1) domain.
Zhou Z, Wang N, Woodson SE, Dong Q, Wang J, Liang Y, Rijnbrand R, Wei L, Nichols JE, Guo JT, Holbrook MR, Lemon SM, Li K
Virology 2011 Jan 20;409(2):175-88
Virology 2011 Jan 20;409(2):175-88
Intracellular activation of interferon regulatory factor-1 by nanobodies to the multifunctional (Mf1) domain.
Möller A, Pion E, Narayan V, Ball KL
The Journal of biological chemistry 2010 Dec 3;285(49):38348-61
The Journal of biological chemistry 2010 Dec 3;285(49):38348-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ISG20 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ISG20 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol