Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003669-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003669-M05, RRID:AB_1111919
- Product name
- ISG20 monoclonal antibody (M05), clone S1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant ISG20.
- Antigen sequence
MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHG
AVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGY
TIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLP
RLAVSD- Isotype
- IgG
- Antibody clone number
- S1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M05), clone S1.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ISG20 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ISG20 transfected lysate using anti-ISG20 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ISG20 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol