HPA021484

ELMO3 antibody from Sigma-Aldrich
CED-12, CED12, ELMO-3, FLJ13824
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021484
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021484, RRID:AB_1848129
Product name
Anti-ELMO3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021484
Antibody type
Polyclonal
Antigen
Engulfment and cell motility protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQ
GASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMG
DEMAHHLYVLQALMLGL
Storage
-20C
Provider Type Product Number
- No reagents -