H00008840-B01P

CCN4 antibody from Abnova Corporation
WISP-1, WISP1, WISP1-OT1, WISP1-UT1

Antibody data

Product number
H00008840-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008840-B01P, RRID:AB_1581934
Product name
WISP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008840-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human WISP1 protein.
Antigen sequence
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFT
PAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT
DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSG
DRPRYAIGVCAHAVGEVEAWHRNCIAYTSPWSPCS
TSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD
IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQ
PKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSR
QVLWINACFCNLSCRNPNDIFADLESYPDFSEIAN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -