Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006424-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006424-A01, RRID:AB_462777
- Product name
- SFRP4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SFRP4.
- Antigen sequence
CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQC
PHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQL
SKRSIQWEERLQEQRRTVQDKKKTAGRTSRSN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of secreted frizzled-related protein 4 correlates with an aggressive phenotype and predicts poor outcome in ovarian cancer patients.
The effects of luteinizing hormone ablation/replacement versus steroid ablation/replacement on gene expression in the primate corpus luteum.
Jacob F, Ukegjini K, Nixdorf S, Ford CE, Olivier J, Caduff R, Scurry JP, Guertler R, Hornung D, Mueller R, Fink DA, Hacker NF, Heinzelmann-Schwarz VA
PloS one 2012;7(2):e31885
PloS one 2012;7(2):e31885
The effects of luteinizing hormone ablation/replacement versus steroid ablation/replacement on gene expression in the primate corpus luteum.
Bishop CV, Hennebold JD, Stouffer RL
Molecular human reproduction 2009 Mar;15(3):181-93
Molecular human reproduction 2009 Mar;15(3):181-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SFRP4 expression in transfected 293T cell line by SFRP4 polyclonal antibody (A01).Lane1:SFRP4 transfected lysate(40 KDa).Lane2:Non-transfected lysate.