HPA009712

SFRP4 antibody from Atlas Antibodies
FRP-4, frpHE, FRZB-2

Antibody data

Product number
HPA009712
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009712, RRID:AB_1856778
Product name
Anti-SFRP4
Provider product page
Atlas Antibodies - HPA009712
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDV
NCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQ
RARDDCEPLMKMYNHSWPESLACDELPVYDRGVCI
SPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.