HPA009712

antibody from Atlas Antibodies

Targeting: SFRP4 FRP-4, frpHE, FRZB-2

Antibody data

Submit

Validation data

Product number: HPA009712 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA009712, RRID:AB_1856778
Product name: Anti-SFRP4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDV NCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQ RARDDCEPLMKMYNHSWPESLACDELPVYDRGVCI SPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SFRP4 protein structure - HPA009712 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and testis tissues using Anti-SFRP4 antibody. Corresponding SFRP4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, endometrium, kidney and testis using Anti-SFRP4 antibody HPA009712 (A) shows similar protein distribution across tissues to independent antibody HPA050585 (B).
Antibody #2 product nr: HPA050585
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in cells in endometrial stroma.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SFRP4 antibody HPA009712.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SFRP4 antibody HPA009712.
Sample type: HUMAN