Antibody data
- Product number
- HPA009712
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009712, RRID:AB_1856778
- Product name
- Anti-SFRP4
- Provider product page
- Atlas Antibodies - HPA009712
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDV
NCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQ
RARDDCEPLMKMYNHSWPESLACDELPVYDRGVCI
SPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and sFRP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401054).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in cells in endometrial stroma.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-SFRP4 antibody HPA009712.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-SFRP4 antibody HPA009712.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human endometrium and testis tissues using Anti-SFRP4 antibody. Corresponding SFRP4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex, endometrium, kidney and testis using Anti-SFRP4 antibody HPA009712 (A) shows similar protein distribution across tissues to independent antibody HPA050585 (B).
- Antibody #2 product nr
- HPA050585
- Antibody provider
- Atlas Antibodies
- Show more