HPA009712

SFRP4 antibody from Sigma-Aldrich
FRP-4, frpHE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009712
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009712, RRID:AB_1856778
Product name
Anti-SFRP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009712
Antibody type
Polyclonal
Antigen
Secreted frizzled-related protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDV
NCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQ
RARDDCEPLMKMYNHSWPESLACDELPVYDRGVCI
SPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
Storage
-20C
Provider Type Product Number
- No reagents -