Antibody data

Product number
H00000799-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000799-M01, RRID:AB_1137116
Product name
CALCR monoclonal antibody (M01), clone 2F7
Provider product page
Abnova Corporation - H00000799-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CALCR.
Antigen sequence
CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARA
AAAAAEAGDIPIYICHQELRNEPANNQGEESAEII
PLNIIEQESSA
Isotype
IgG
Antibody clone number
2F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -