Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000799-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000799-M01, RRID:AB_1137116
- Product name
- CALCR monoclonal antibody (M01), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CALCR.
- Antigen sequence
CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARA
AAAAAEAGDIPIYICHQELRNEPANNQGEESAEII
PLNIIEQESSA- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of the calcitonin receptor in osteoarthritic chondrocytes.
Segovia-Silvestre T, Bonnefond C, Sondergaard BC, Christensen T, Karsdal MA, Bay-Jensen AC
BMC research notes 2011 Oct 13;4:407
BMC research notes 2011 Oct 13;4:407
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CALCR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol