HPA016965

EIF4G2 antibody from Atlas Antibodies
DAP5, NAT1, p97
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016965
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016965, RRID:AB_1848100
Product name
Anti-EIF4G2
Provider product page
Atlas Antibodies - HPA016965
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQST
TFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEE
EEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKC
IKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLD
HERAKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -