HPA003415

LTBP2 antibody from Sigma-Aldrich
C14orf141, LTBP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003415
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003415, RRID:AB_1079284
Product name
Anti-LTBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003415
Antibody type
Polyclonal
Antigen
Latent-transforming growth factor beta-binding protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPP
AGTLSGLSQTHPSQQHVGLSRTVRLHPTATASSQL
SSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLT
EKIKKIKIVFTPTICKQTCARGHCANSCERG
Storage
-20C
Provider Type Product Number
- No reagents -