HPA007234

CD81 antibody from Atlas Antibodies
TAPA-1, TAPA1, TSPAN28
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007234
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007234, RRID:AB_1846333
Product name
Anti-CD81
Provider product page
Atlas Antibodies - HPA007234
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVK
TFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIIS
NLFKEDCHQKIDDLFSGKLYL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -