HPA016567

KCNK16 antibody from Sigma-Aldrich
K2p16.1, TALK-1, TALK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016567, RRID:AB_1855564
Product name
Anti-KCNK16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016567
Antibody type
Polyclonal
Antigen
Potassium channel subfamily K member 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSRDQFQLEKLRFLENYTCLDQWAMEQFVQVIMEA
WVKGVNPKGNSTNPSN
Storage
-20C
Provider Type Product Number
- No reagents -