Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182757 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Grainyhead-Like 3 (Drosophila) (GRHL3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRHL3 antibody: synthetic peptide directed towards the C terminal of human GRHL3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPN
VHFSS LQRSGGAAPS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The epidermal differentiation-associated Grainyhead gene Get1/Grhl3 also regulates urothelial differentiation.
The identification and characterization of human Sister-of-Mammalian Grainyhead (SOM) expands the grainyhead-like family of developmental transcription factors.
Yu Z, Mannik J, Soto A, Lin KK, Andersen B
The EMBO journal 2009 Jul 8;28(13):1890-903
The EMBO journal 2009 Jul 8;28(13):1890-903
The identification and characterization of human Sister-of-Mammalian Grainyhead (SOM) expands the grainyhead-like family of developmental transcription factors.
Ting SB, Wilanowski T, Cerruti L, Zhao LL, Cunningham JM, Jane SM
The Biochemical journal 2003 Mar 15;370(Pt 3):953-62
The Biochemical journal 2003 Mar 15;370(Pt 3):953-62
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting