Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183803 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Grainyhead-Like 3 (Drosophila) (GRHL3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRHL3 antibody: synthetic peptide directed towards the C terminal of human GRHL3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKV
YKKCK RGILVNMDNN- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Targeting of the tumor suppressor GRHL3 by a miR-21-dependent proto-oncogenic network results in PTEN loss and tumorigenesis.
The identification and characterization of human Sister-of-Mammalian Grainyhead (SOM) expands the grainyhead-like family of developmental transcription factors.
Darido C, Georgy SR, Wilanowski T, Dworkin S, Auden A, Zhao Q, Rank G, Srivastava S, Finlay MJ, Papenfuss AT, Pandolfi PP, Pearson RB, Jane SM
Cancer cell 2011 Nov 15;20(5):635-48
Cancer cell 2011 Nov 15;20(5):635-48
The identification and characterization of human Sister-of-Mammalian Grainyhead (SOM) expands the grainyhead-like family of developmental transcription factors.
Ting SB, Wilanowski T, Cerruti L, Zhao LL, Cunningham JM, Jane SM
The Biochemical journal 2003 Mar 15;370(Pt 3):953-62
The Biochemical journal 2003 Mar 15;370(Pt 3):953-62
No comments: Submit comment
No validations: Submit validation data