Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055215-B03 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FANCI MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FANCI protein.
- Antigen sequence
MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLV
YQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQS
GDE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FANCI expression in transfected 293T cell line (H00055215-T04) by FANCI MaxPab polyclonal antibody.Lane 1: FANCI transfected lysate(8.14 KDa).Lane 2: Non-transfected lysate.