HPA024305

GPI antibody from Sigma-Aldrich
AMF, NLK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024305
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024305, RRID:AB_1849922
Product name
Anti-GPI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024305
Antibody type
Polyclonal
Antigen
Glucose-6-phosphate isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDM
ESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFY
QLIHQGTKMIPCDFLIPVQT
Storage
-20C
Provider Type Product Number
- No reagents -