HPA012126

ELMOD3 antibody from Sigma-Aldrich
DFNB88, FLJ21977, RBED1, RBM29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012126
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012126, RRID:AB_1848130
Product name
Anti-ELMOD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012126
Antibody type
Polyclonal
Antigen
ELMO domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWEPRVVSTEVVRAQEEWEAVDTIQPETGSQASSE
QPGQLISFSEALQHFQTVDLSPFKKRIQPTIRRTG
LAALRHYLFGPPKLHQRLREERDLVLTIAQCGLDS
QDPVHG
Storage
-20C
Provider Type Product Number
- No reagents -