HPA005908

UCHL5 antibody from Atlas Antibodies
CGI-70, INO80R, UCH37
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005908
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005908, RRID:AB_1858585
Product name
Anti-UCHL5
Provider product page
Atlas Antibodies - HPA005908
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD
VIRQVHNSFARQQMFEFDTKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -