HPA005908

UCHL5 antibody from Sigma-Aldrich
CGI-70, INO80R, UCH37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005908
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005908, RRID:AB_1858585
Product name
Anti-UCHL5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005908
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase isozyme L5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD
VIRQVHNSFARQQMFEFDTKT
Storage
-20C
Provider Type Product Number
- No reagents -