ABIN1545369

STPG1 antibody from antibodies-online
C1orf201, FLJ33340, MAPO2

Antibody data

Product number
ABIN1545369
Provider
antibodies-online
Product name
anti-Sperm-Tail PG-Rich Repeat Containing 1 (STPG1) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545369
Antibody type
Polyclonal
Antigen
The immunogen for Anti-STPG1 antibody is: synthetic peptide directed towards the C-terminal region of Human STPG1
Reactivity
Human
Host
Rabbit
Antigen sequence
SCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKT
LFPKN PILNFSAQPS
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -