H00090529-B01P

STPG1 antibody from Abnova Corporation
C1orf201, FLJ33340, MAPO2
No application information provided.

Antibody data

Product number
H00090529-B01P
Provider
Abnova Corporation
Product name
C1orf201 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00090529-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C1orf201 protein.
Antigen sequence
MNALANIPDVPVKYRKNDIPGPGFYNVIHQSPVSN
SVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIP
SDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNY
YNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKG
PPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLT
STGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQP
SPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVS
NTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNED
KKWIPVL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -