PAB21676

STPG1 antibody from Abnova Corporation
C1orf201, FLJ33340, MAPO2

Antibody data

Product number
PAB21676
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21676, RRID:AB_10965971
Product name
C1orf201 polyclonal antibody
Provider product page
Abnova Corporation - PAB21676
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human C1orf201.
Reactivity
Human
Host
Rabbit
Antigen sequence
PILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKH
FISSASFVSNTSRWTAAPPQPGLPGPATYKPELPG
KQSFLYNEDKKWIPVL
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -