HPA024301

STPG1 antibody from Sigma-Aldrich
C1orf201, FLJ33340, MAPO2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024301
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024301, RRID:AB_1845634
Product name
Anti-C1orf201 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024301
Antibody type
Polyclonal
Antigen
UPF0490 protein C1orf201 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKH
FISSASFVSNTSRWTAAPPQPGLPGPATYKPELPG
KQSFLYNEDKKWIPVL
Storage
-20C
Provider Type Product Number
- No reagents -