Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004085-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004085-M01, RRID:AB_425533
- Product name
- MAD2L1 monoclonal antibody (M01), clone 2E2-1D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MAD2L1.
- Antigen sequence
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQR
GIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE
QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIE
CDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT
FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFI
TNSEEVRLRSFTTTIHKVNSMVAYKIPVND- Isotype
- IgG
- Antibody clone number
- 2E2-1D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
Yeh PC, Yeh CC, Chen YC, Juang YL
The Journal of biological chemistry 2012 Apr 6;287(15):11704-16
The Journal of biological chemistry 2012 Apr 6;287(15):11704-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAD2L1 monoclonal antibody (M01), clone 2E2-1D6 Western Blot analysis of MAD2L1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody (M01), clone 2E2-1D6.Lane 1: MAD2L1 transfected lysate(23.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAD2L1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol