HPA019964

PDCD2L antibody from MilliporeSigma / Merck KGaA
MGC13096
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019964
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019964, RRID:AB_1855105
Product name
Anti-PDCD2L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019964
Antibody type
Polyclonal
Antigen
Programmed cell death protein 2-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEG
ADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTAR
LQDLRLQDAVLGAAHPVPPG
Storage
-20C
Provider Type Product Number
- No reagents -