Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502952 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Peroxiredoxin 1 (PRDX1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKG
KYVVF FFYPLDFTFV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Up-regulation of peroxiredoxin 1 in lung cancer and its implication as a prognostic and therapeutic target.
Kim JH, Bogner PN, Baek SH, Ramnath N, Liang P, Kim HR, Andrews C, Park YM
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Apr 15;14(8):2326-33
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Apr 15;14(8):2326-33
No comments: Submit comment
No validations: Submit validation data