Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007730 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007730, RRID:AB_1855204
- Product name
- Anti-PRDX1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKL
NCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPL
VSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGIL
RQITVNDLPVGRSVDETLRL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Peroxiredoxin-1 protects estrogen receptor α from oxidative stress-induced suppression and is a protein biomarker of favorable prognosis in breast cancer.
Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma
Human Protein Atlas of redox systems — What can be learnt?
O'Leary PC, Terrile M, Bajor M, Gaj P, Hennessy BT, Mills GB, Zagozdzon A, O'Connor DP, Brennan DJ, Connor K, Li J, Gonzalez-Angulo AM, Sun HD, Pu JX, Pontén F, Uhlén M, Jirström K, Nowis DA, Crown JP, Zagozdzon R, Gallagher WM
Breast cancer research : BCR 2014 Jul 10;16(4):R79
Breast cancer research : BCR 2014 Jul 10;16(4):R79
Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma
Kamper P, Ludvigsen M, Bendix K, Hamilton-Dutoit S, Rabinovich G, Moller M, Nyengaard J, Honore B, d'Amore F
Blood 2011 June;117(24):6638-6649
Blood 2011 June;117(24):6638-6649
Human Protein Atlas of redox systems — What can be learnt?
Dammeyer P, Arnér E
Biochimica et Biophysica Acta (BBA) - General Subjects 2011 January;1810(1):111-138
Biochimica et Biophysica Acta (BBA) - General Subjects 2011 January;1810(1):111-138
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PRDX1 antibody. Corresponding PRDX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN