HPA008798

PLPPR4 antibody from Sigma-Aldrich
KIAA0455, LPPR4, PHP1, PRG-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008798
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008798, RRID:AB_1856103
Product name
Anti-RP4-788L13.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008798
Antibody type
Polyclonal
Antigen
Lipid phosphate phosphatase-related protein type 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRAGSSGGRGECDISGAGRLGLEEAARLSCAVHTS
PGGGRRPGQAAGMSAKERPKGKVIKDSVTL
Storage
-20C
Provider Type Product Number
- No reagents -