Antibody data

Product number
HPA059738
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059738, RRID:AB_2684116
Product name
Anti-COL1A2
Provider product page
Atlas Antibodies - HPA059738
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKH
VWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLL
ANYAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -