HPA005911

SLC16A7 antibody from Atlas Antibodies
MCT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005911, RRID:AB_1669284
Product name
Anti-SLC16A7
Provider product page
Atlas Antibodies - HPA005911
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKV
NKYLDFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -