HPA005911

SLC16A7 antibody from Sigma-Aldrich
MCT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005911, RRID:AB_1853659
Product name
Anti-SLC16A7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005911
Antibody type
Polyclonal
Antigen
Monocarboxylate transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKV
NKYLDFS
Storage
-20C
Provider Type Product Number
- No reagents -