HPA016812

RNF41 antibody from Sigma-Aldrich
NRDP1, SBBI03
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016812, RRID:AB_1856370
Product name
Anti-RNF41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016812
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase NRDP1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAVLQAVIKRSLVESGCPASIVNELIENAHERSWP
QGLATLETRQMNRRYYENYVAKRIPGKQAVVVMAC
ENQHMGDDMVQEPGLVMIFAHGVEEI
Storage
-20C
Provider Type Product Number
- No reagents -