Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00113130-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00113130-B01P, RRID:AB_1572451
- Product name
- CDCA5 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human CDCA5 protein.
- Antigen sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGS
ELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEV
PAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKT
HSVPATPTSTPVPNPEAESSSKEGELDARDLEMSK
KVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAE
DLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISP
PPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAE
QFDLLVE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CDCA5 expression in transfected 293T cell line (H00113130-T01) by CDCA5 MaxPab polyclonal antibody.Lane 1: CDCA5 transfected lysate(27.72 KDa).Lane 2: Non-transfected lysate.
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDCA5 MaxPab polyclonal antibody. Western Blot analysis of CDCA5 expression in Hela S3 NE.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CDCA5 expression in transfected 293T cell line (H00113130-T01) by CDCA5 MaxPab polyclonal antibody.Lane 1: CDCA5 transfected lysate(27.72 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to CDCA5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol