HPA023691

CDCA5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023691, RRID:AB_1846392
Product name
Anti-CDCA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023691
Antibody type
Polyclonal
Antigen
Sororin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAV
QSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSV
PATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR
Storage
-20C
Provider Type Product Number
- No reagents -