HPA004798

C1orf198 antibody from Atlas Antibodies
DKFZp667D152, FLJ14525, FLJ16283, FLJ38847, MGC10710
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004798
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004798, RRID:AB_1668892
Product name
Anti-C1orf198
Provider product page
Atlas Antibodies - HPA004798
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALKSSQGSRSSSLDALGPTRKEEEASFWKINAERS
RGEGPEAEFQSLTPSQIKSMEKGEKVLPPCYRQEP
APKDREAKVERPSTLRQEQRPLPNVSTERERPQPV
QAFSSALHEAAPSQLEGKLPSPDVRQDDGEDTLFS
EPKFAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -