HPA004798

C1orf198 antibody from Sigma-Aldrich
DKFZp667D152, FLJ14525, FLJ16283, FLJ38847, MGC10710
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004798
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004798, RRID:AB_1848722
Product name
Anti-C1orf198 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004798
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf198 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKSSQGSRSSSLDALGPTRKEEEASFWKINAERS
RGEGPEAEFQSLTPSQIKSMEKGEKVLPPCYRQEP
APKDREAKVERPSTLRQEQRPLPNVSTERERPQPV
QAFSSALHEAAPSQLEGKLPSPDVRQDDGEDTLFS
EPKFAQ
Storage
-20C
Provider Type Product Number
- No reagents -