HPA004941

KIAA1217 antibody from Sigma-Aldrich
DKFZP761L0424, SKT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004941
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004941, RRID:AB_2130659
Product name
Anti-KIAA1217 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004941
Antibody type
Polyclonal
Antigen
Sickle tail protein homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKG
TDAAQAAQYMAMEKATAAEVLKSQEEAAHTSGQPF
HSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQ
Storage
-20C
Provider Type Product Number
- No reagents -