Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503505 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACADS antibody: synthetic peptide directed towards the N terminal of human ACADS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFT
SGDKI GCFALSEPGN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Short-chain acyl-CoA dehydrogenase gene mutation (c.319C>T) presents with clinical heterogeneity and is candidate founder mutation in individuals of Ashkenazi Jewish origin.
Tein I, Elpeleg O, Ben-Zeev B, Korman SH, Lossos A, Lev D, Lerman-Sagie T, Leshinsky-Silver E, Vockley J, Berry GT, Lamhonwah AM, Matern D, Roe CR, Gregersen N
Molecular genetics and metabolism 2008 Feb;93(2):179-89
Molecular genetics and metabolism 2008 Feb;93(2):179-89
No comments: Submit comment
No validations: Submit validation data