HPA004799

ACADS antibody from Sigma-Aldrich
ACAD3, SCAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004799
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004799, RRID:AB_1844471
Product name
Anti-ACADS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004799
Antibody type
Polyclonal
Antigen
Short-chain specific acyl-CoA dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSS
TANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGR
IGIASQALGIAQTALDCAVNYAENRMAFGAPLTKL
QVIQFKLAD
Storage
-20C
Provider Type Product Number
- No reagents -