HPA003025

RBM25 antibody from Sigma-Aldrich
fSAP94, NET52, RNPC7, S164, Snu71
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003025
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003025, RRID:AB_1079748
Product name
Anti-RBM25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003025
Antibody type
Polyclonal
Antigen
Probable RNA-binding protein 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNA
TKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDW
SIVDSILMERRIRPWINKKIIEYIGEEEATLVDFV
CSKVMAHSSPQSILDDVAMVLDEEAEV
Storage
-20C
Provider Type Product Number
- No reagents -