HPA024299

PLIN1 antibody from Sigma-Aldrich
PLIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024299
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024299, RRID:AB_1855467
Product name
Anti-PLIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024299
Antibody type
Polyclonal
Antigen
Perilipin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAAN
ELACRGLDHLEEKIPALQYPPEKIASELKDTISTR
LRSARNSISVPIASTSDKVLGAALAGCELAWGVAR
DTAEFAANTRAGRLASGGADLALGSIEKVVE
Storage
-20C
Provider Type Product Number
- No reagents -